Recombinant Danio rerio G-protein coupled receptor 183-A(gpr183a)

Code CSB-CF404232DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A5PLE7
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence METTSANFTQNDSNVCTNLYNHRGWAQYFLPAMYSLICIVGLLGNVLALHVIWPNLKKIN STTLYSANLVVSDILFSLALPLRVVYYARGFDWPMGEGLCKAVALLFYINMYAGVNFMTC LSVDRFIAVVLPLRFSRFRKVQKVRYICGVVWVVVLMQTLPLLSMPMTNIEQSGHITCME YPNFEKIDNLPVMLIGAVVLGFGIPVITILVCYTALCLKLRHLAKSNKLTEKSGRSSKAI GVICTVILVFVVCYSPYHVDLLQYMIKKLRYDPDCSELHKFQISLHITVCFMNLNSCLDP FIYFFACKGYKKKVLKLLKKQVSMSFSSVVRTSPEGSSKDVFGNDKIQMNSRSFQKERSS VLLNSLEQ
Source in vitro E.coli expression system
Gene Names gpr183a
Protein Names Recommended name: G-protein coupled receptor 183-A
Expression Region 1-368
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled receptor expressed in lymphocytes that acts as a chemotactic receptor for B-cells, T-cells, splenic dendritic cells, monocytes/macrophages and astrocytes (By similarity). Receptor for oxysterol 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC) and other related oxysterols (By similarity). Mediates cell positioning and movement of a number of cells by binding the 7-alpha,25-OHC ligand that forms a chemotactic gradient (By similarity). Binding of 7-alpha,25-OHC mediates the correct localization of B-cells during humoral immune responses (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: dre:556770

STRING: 7955.ENSDARP00000010296

UniGene: Dr.111220

Related Products

gpr183a Antibodies

gpr183a Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

gpr183a Proteins

gpr183a Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.