Recombinant Danio rerio Green-sensitive opsin-3(opn1mw3)

Code CSB-CF805227DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8AYM7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MNGTEGNNFYIPMSNRTGLVRSPYEYPQYYLAEPWQFKLLAVYMFFLMCFGFPINGLTLV VTAQHKKLRQPLNFILVNLAVAGTIMVCFGFTVTFYTAINGYFVLGPTGCAIEGFMATLG GQISLWSLVVLAIERYIVVCKPMGSFKFSSNHAFAGIGFTWIMALSCAAPPLVGWSRYIP EGMQCSCGPDYYTLNPDYNNESYVLYMFCCHFIFPVTTIFFTYGRLVCTVKAAAAQQQES ESTQKAEREVTRMVILMVLGFLVAWTPYASVAAWIFFNRGAAFSAQFMAVPAFFSKSSSI FNPIIYVLLNKQFRNCMLTTLFCGKNPLGDDESSTVSTSKTEVSSVSPA
Source in vitro E.coli expression system
Gene Names opn1mw3
Protein Names Recommended name: Green-sensitive opsin-3 Alternative name(s): Green cone photoreceptor pigment 3 Opsin RH2-3 Opsin-1, medium-wave-sensitive 3
Expression Region 1-349
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Database Links

KEGG: dre:360152

STRING: 7955.ENSDARP00000001943

UniGene: Dr.25438

Related Products

opn1mw3 Antibodies

opn1mw3 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

opn1mw3 Proteins

opn1mw3 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.