Recombinant Danio rerio Leukocyte cell-derived chemotaxin 1(lect1)

Code CSB-CF350134DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P58239
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence SATRMRRQTSAGVNRQPARRRNSTASARDERPTGPEYNPENPYHQNQGSEGTMVFDPMLD HRGICCTECHRSYTHCERVCEPLGGYWPWPYNYHGCRPVCRLIMPCRWWAARVLGLV
Source in vitro E.coli expression system
Gene Names cnmd
Protein Names Recommended name: Leukocyte cell-derived chemotaxin 1 Cleaved into the following 2 chains: 1. Chondrosurfactant protein Short name= 2. CH-SP 3. Chondromodulin-1 Alternative name(s): Chondromodulin-I Short name= ChM-I
Expression Region 170-286
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Bifunctional growth regulator. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization (By similarity).
Subcellular Location Chondromodulin-1: Secreted, extracellular space, extracellular matrix
Protein Families Chondromodulin-1 family
Database Links

STRING: 7955.ENSDARP00000022495

UniGene: Dr.76996

Related Products

cnmd Antibodies

cnmd Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

cnmd Proteins

cnmd Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.