Recombinant Danio rerio Melanopsin-A(opn4a)

Code CSB-CF641626DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2KNE5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MMSGAAHSVRKGISCPTQDPNCTRIVESLSAWNDSVMSAYRLVDLPPTTTTTTSVAMVEE SVYPFPTVDVPDHAHYTIGAVILTVGITGMLGNFLVIYAFSRSRTLRTPANLFIINLAIT DFLMCATQAPIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRP LASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAY TMLLFIFVFFIPLIVIIYCYFFIFRSIRTTNEAVGKINGDNKRDSMKRFQRLKNEWKMAK IALIVILMYVISWSPYSTVALTAFAGYSDFLTPYMNSVPAVIAKASAIHNPIIYAITHPK YRLAIAKYIPCLRLLLCVPKRDLHSFHSSLMSTRRSTVTSQSSDMSGRFRRTSTGKSRLS SASDSESGWTDTEADLSSMSSRPASRQVSCDISKDTAEMPDFKPCNSSSFKSKLKSHDSG IFEKSSSDVDDVSVAGIIQPDRTLTNAGDITDVPISRGAIGRIPSIVITSESSSLLPSVR PTYRISRSNVSTVGTNPARRDSRGGVQQGAAHLSNAAETPESGHIDNHRPQYL
Source in vitro E.coli expression system
Gene Names opn4a
Protein Names Recommended name: Melanopsin-A Alternative name(s): Mammalian-like melanopsin Melanopsin-M Opsin-4-A Opsin-4M
Expression Region 1-593
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor implicated in non-image-forming responses to light. May be able to isomerize covalently bound all-trans retinal back to 11-cis retinal (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Database Links

KEGG: dre:571624

STRING: 7955.ENSDARP00000109133

UniGene: Dr.94492

Related Products

opn4a Antibodies

opn4a Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

opn4a Proteins

opn4a Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.