Recombinant Danio rerio Melanopsin-like(opn4l)

Code CSB-CF628837DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q1JPS6
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MSHHSSWRGHHCAPGDINCTAGFKESLGSRNYKLLHVPVHGPTHSHHHDPPHPFPTVDVP DHAHYIIGSVILIVGITGVIGNALVVYVFCRSRTLRTAGNMFIVNLAVADFLMSVTQSPV FFAASLHRRWVFGERPCELYAFCGALFGICSMMTLTAIAADRCLAITQPLALVSRVSRRK AGAVLVVVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMTFTPSVRAYTILLFVFVFFI PLGIIGSCYFAIFQTIRAAGKEIRELDCGETHKVYERMQNEWKMAKVALVVIVLFIISWS PYSVVALTATAGYSHFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRVAIARYIPVLRP ILRVKEKDLRSSFSSGSVSSRRPTLTSQCSLGVSMGNAARANGRWGKTRLSSASDSDSCW TESEADGSSVSSLTFGRRVSTEISTDTVILSSGSSVSNASGQKSERAHKVISVPVPSITF ETDAADGESLSDGKALLGGN
Source in vitro E.coli expression system
Gene Names opn4l
Protein Names Recommended name: Melanopsin-like Alternative name(s): Melanopsin Opsin-4-like
Expression Region 1-500
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor implicated in non-image-forming responses to light.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Expressed in a subset of retinal horizontal cells.
Database Links

KEGG: dre:352918

STRING: 7955.ENSDARP00000002787

UniGene: Dr.24957

Related Products

opn4l Antibodies

opn4l Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

opn4l Proteins

opn4l Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.