Recombinant Danio rerio Melatonin receptor type 1B-B(mtnr1bb)

Code CSB-CF342337DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P51049
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MPENIAFLTNSTDLGHVGRALGSSARPAWAIAVLASVLIFTTVVDVLGNLLVIISVFRNR KLRNAGNVFVVSLAFADLVVAFYPYPLVLYAIFHDGWSLGETQCKISGFLMGLSVIGSVF NITGIAINRYCYICHSFAYGRLYSFRNTLLLVALIWALTVLAILPNFFVGSLSYDPRVYS CTFTQTASSSYTVVVVVVHFLVPIAVVTFCYLRIWVLVIQVRRKVKSEERSRVRPSDLRN FVTMFVVFVLFAICWAPLNLIGLVVAINPEVMAPRVPEWLFVVSYFMAYFNSCLNAIIYG LLNRNFRKEYVRIMTAVWIPRRFVTETSRAATDGMRSKPSPAINNNE
Source in vitro E.coli expression system
Gene Names mtnr1bb
Protein Names Recommended name: Melatonin receptor type 1B-B Short name= Mel-1B-R-B Short name= Mel1b receptor B Alternative name(s): Melatonin receptor Mel1b Z2.6-4 zMel1b-1
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibits adenylate cyclase activity (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: dre:30668

STRING: 7955.ENSDARP00000107818

UniGene: Dr.83649

Related Products

mtnr1bb Antibodies

mtnr1bb Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

mtnr1bb Proteins

mtnr1bb Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.