Recombinant Danio rerio Membrane progestin receptor gamma-A(paqr5a)

Code CSB-CF773629DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7ZVH1
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MLNLIKLPQVFTINQVPKVFHEDGIISGYRHPCSSAKDCVLSLFQLTNETLNIWTHFLPT WFFLWKLLTVVLVLEDWRDPFIWPFLVFLLSCCVYPLASSCAHTFSTMSERARHICFFFD YGALSFYSLGSAIIYSSYSFPDKWVNGTFHLNYVSIAVVNSIISTALACYSRLGLPFLEY NCHSIKRPSGKLDQKLCKCLRIIAFVYPYLFDNIPLFYRIFVCAGEGCTVNEANTVHYQH TSLAFFTGFLFATHLPERLAPGSFDYIGHSHQLFHVFAIIGTYFQMTAIELDMAARKQWL HAHLPPVTFLNTVGAAFFSVVSGLCIVYVFSLSLFSTRGVKNKSF
Source in vitro E.coli expression system
Gene Names paqr5a
Protein Names Recommended name: Membrane progestin receptor gamma-A Short name= mPR gamma-A Alternative name(s): Progestin and adipoQ receptor family member V-A
Expression Region 1-345
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Steroid membrane receptor. Binds progesterone. May be involved in oocyte maturation (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Database Links

KEGG: dre:393156

STRING: 7955.ENSDARP00000060310

UniGene: Dr.83207

Related Products

paqr5a Antibodies

paqr5a Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

paqr5a Proteins

paqr5a Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.