Recombinant Danio rerio Organic solute transporter subunit alpha(osta)

Code CSB-CF724125DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q66I08
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence METSNFTLFDPRCRAEAPFAIDAIKQLDIFGKVLYTVLTLMATASMLVFIEECIYIYKKV PAHKKSTIIWVTGVAPVMAIMSCLGMWVPRATMFTDMTSATYFAIVVFKFLILMIEEVGG DNAFLRRCEKQTFKISTGPCCCCCPCLPNVPITRRSLFILKLGSYQFALMKLVLTIFSIV LWTNGSFSLTNVSASGAAIWINSFIGVLTIIALWPVAIMFMHVREALRTLKIVPKYAMYQ LVLILSQLQTAIINILALNGTIACSPPYSSQARGYMMSQQLLIVEMFIITLVTRVLYRRQ YEPIPEPDDVEEKKTVLSSKKAIDVA
Source in vitro E.coli expression system
Gene Names slc51a
Protein Names Recommended name: Organic solute transporter subunit alpha Short name= OST-alpha
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.
Subcellular Location Cell membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families OST-alpha family
Database Links

KEGG: dre:447807

STRING: 7955.ENSDARP00000066630

UniGene: Dr.27305

Related Products

slc51a Antibodies

slc51a Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

slc51a Proteins

slc51a Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.