Recombinant Danio rerio Peroxisomal membrane protein PEX16(pex16)

Code CSB-CF709063DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4QRH7
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MEKLTRVFERYQEYVRTSPAAASHLESTVRALSYLIAGRFSDSHEISELVYSASNLLVLL NDGILRKNLSRTLPMSISQQKLLTWLSVLEYVEVFVEMAAAKMWGDAGRWLVIVLIQIAK AVLRCLLLFWYKSGIQTSPPIIPLDRDSQLCSQDNNEEEDDEDSSFVGQRSGRVVRPLGS APSLQSRLWGLPRKKKVSRNQEEELHSSPTPLGLQETIAESLYIARPLLHLASLGICGKR SWKPWILSGLLEITSFSLLSDMKALNRRERAEMRRRAFLLLYYLLRSPFYDRYSETKILF LLRFLADYVPGVGLVARPLMEYLPIWQKIYFYNWG
Source in vitro E.coli expression system
Gene Names pex16
Protein Names Recommended name: Peroxisomal membrane protein PEX16 Alternative name(s): Peroxin-16 Peroxisomal biogenesis factor 16
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in peroxisome biogenesis.
Subcellular Location Peroxisome membrane, Multi-pass membrane protein
Protein Families Peroxin-16 family
Database Links

KEGG: dre:573990

STRING: 7955.ENSDARP00000111182

UniGene: Dr.79352

Related Products

pex16 Antibodies

pex16 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

pex16 Proteins

pex16 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.