Recombinant Danio rerio Post-GPI attachment to proteins factor 2(pgap2)

Code CSB-CF685601DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5BL33
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MQQVPYGSVDRDKPLIRVPFTRLAVITVCLPLLGLVACIVLAMLYHYNDATYTHCQVPNY LPSISAAISLTPERYIWRFSIGLHSAPRFLVAAAYLSFYRGRFSRRLTEQLLSGFTFLLA LSENVGLLLLTYVSSTETYSVHKSGFILFIGSSLFHMLCTCKLWSLIVKYSISSEEMMSY WFKLRLFLFNGGCCVLAVYFYRRHNTYCEEGITHASRCVSIWWCCPTWPST
Source in vitro E.coli expression system
Gene Names pgap2
Protein Names Recommended name: Post-GPI attachment to proteins factor 2 Alternative name(s): FGF receptor-activating protein 1
Expression Region 1-231
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the lipid remodeling steps of GPI-anchor maturation. Required for stable expression of GPI-anchored proteins at the cell surface (By similarity).
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families PGAP2 family
Database Links

KEGG: dre:541417

STRING: 7955.ENSDARP00000065502

UniGene: Dr.78636

Related Products

pgap2 Antibodies

pgap2 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

pgap2 Proteins

pgap2 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.