Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF017789DIL |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | A8WFS8 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Sequence | DKEPVYRDCVKHCVRANCTGARLRGFQSTQPPYMALTGWTCRDDCRYQCMWTTVGLYQAE GYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPCQSPMYHTITAFS LVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLL ILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNRRILPYWWRCGMVVLLL HGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHLLNTEKPGVKLD |
| Source | in vitro E.coli expression system |
| Gene Names | pgap3 |
| Protein Names | Recommended name: Post-GPI attachment to proteins factor 3 Alternative name(s): PER1-like domain-containing protein 1 |
| Expression Region | 20-316 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full Length of Mature Protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Involved in the lipid remodeling steps of GPI-anchor maturation. |
| Subcellular Location | Golgi apparatus membrane, Multi-pass membrane protein |
| Protein Families | PGAP3 family |
| Database Links |
KEGG: dre:100136873 UniGene: Dr.151099 |
pgap3 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA017789XA01DIL | PGAP3 Antibody | Danio rerio (Zebrafish) (Brachydanio rerio) | ELISA, WB (ensure identification of antigen) |
pgap3 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP017789DIL1 CSB-EP017789DIL1 CSB-BP017789DIL1 CSB-MP017789DIL1 |
Recombinant Danio rerio Post-GPI attachment to proteins factor 3(pgap3),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse Peroxisome proliferator-activated receptor gamma(Pparg)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Secreted Ly-6/uPAR-related protein 1(SLURP1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Ras-related protein Rab-10(Rab10)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Zaire ebolavirus Envelope glycoprotein(GP),partial
Express system: E.coli
Species: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)
Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial(Cyp27b1)
Express system: E.coli
Species: Mus musculus (Mouse)
