Recombinant Danio rerio Post-GPI attachment to proteins factor 3(pgap3)

Code CSB-CF017789DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A8WFS8
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence DKEPVYRDCVKHCVRANCTGARLRGFQSTQPPYMALTGWTCRDDCRYQCMWTTVGLYQAE GYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPCQSPMYHTITAFS LVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLL ILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNRRILPYWWRCGMVVLLL HGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHLLNTEKPGVKLD
Source in vitro E.coli expression system
Gene Names pgap3
Protein Names Recommended name: Post-GPI attachment to proteins factor 3 Alternative name(s): PER1-like domain-containing protein 1
Expression Region 20-316
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the lipid remodeling steps of GPI-anchor maturation.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein
Protein Families PGAP3 family
Database Links

KEGG: dre:100136873

UniGene: Dr.151099

Related Products

pgap3 Antibodies

pgap3 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

pgap3 Proteins

pgap3 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.