Recombinant Danio rerio Presenilins-associated rhomboid-like protein, mitochondrial(parl)

Code CSB-CF707485DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q58EK4
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence FRKTERPSESKKGVQETEAEAGGHNRAVPPKPVPPLPPRRPHQLFRPLVFTVGFTGCSFG AAAILQYESVKSRVQLAIEEAKEEKRDTLLEGHDTTYWHNWWNQLSNFQKQVILLISAVD DFWSGLSEGQKTVTGIIALNTVVLCCWRVPAMQRFLVKYFTSNPASKTRCLPMVLSSFSH YSVIHMVVNMYVLWTFSSSIVSLLGREQFLALYLSGGVISTFVSYVFKTATGRLGPSLGA SGSIMTVLAAVCTKIPEAKLGIVLLPVISFSAGNALKALVALDIAGLVLGWRFFDHAAHL GGALFGVWYIGYGHELIWRKREPLIKFWHELRNMSPGRPGPGGGGG
Source in vitro E.coli expression system
Gene Names parl
Protein Names Recommended name: Presenilins-associated rhomboid-like protein, mitochondrial EC= 3.4.21.105
Expression Region 38-383
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the control of apoptosis during postnatal growth. Essential for proteolytic processing of an antiapoptotic form of opa1 which prevents the release of mitochondrial cytochrome c in response to intrinsic apoptoptic signals (By similarity).
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family
Database Links

KEGG: dre:541485

STRING: 7955.ENSDARP00000057438

UniGene: Dr.20668

Related Products

parl Antibodies

parl Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

parl Proteins

parl Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.