Recombinant Danio rerio Protein FAM162B(fam162b)

Code CSB-CF008112DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A3KP48
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MFSMIRGPRAAFGTLIGQWRRGMMTTGNRRLCIKPQEGPSASPQTQRPGFKLPGYRPSDW DKKMLMWSGRFKTVEQIPEFVSFEMIDAARNRVRVKACYIMMGLTIFACLVMIVSGKKAV SRKESLIAINMEKKAKWREDAQREKEENALDAKAQ
Source in vitro E.coli expression system
Gene Names fam162b
Protein Names Recommended name: Protein FAM162B
Expression Region 1-155
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families UPF0389 family
Database Links

KEGG: dre:336363

STRING: 7955.ENSDARP00000114467

UniGene: Dr.76028

Related Products

fam162b Antibodies

fam162b Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

fam162b Proteins

fam162b Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.