Recombinant Danio rerio Protein FAM73B(fam73b)

Code CSB-CF707689DIL
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
miga2
Uniprot No.
Alternative Names
miga2; fam73b; zgc:113131; Mitoguardin 2; Protein FAM73B
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Region
1-596
Target Protein Sequence
MSFRSAEGVSIMQALAMTVAEIPVFLYSTFGQSIFSQLKLSPSLKKVLFATALGSVALAL TAHQLKRRGRKRKQTLGKEAQKPVGIPEQLLRSSRPASLKRGPVPARQMMSPSTRSNDTL SGVSSIAQSKHSSSSHSIASMRVPSSPNQSVNAGAAWEAEPVAEEPAVGEDANAENLYLM GMELFEEALRKWELALNIRHRSHSRASASNSQGSELVERHSPEVRNHQFAERLETLLHRA YHLQEDFGSTIPPDSLLADLESEGTLILPTLGSSHPIQDDDATTVTSDDSFFSAAELFET FSLEDSFHLLKPAALYEEALSLVKDGDVACRSLRTELLECYSDQDFLAKLHCVRQAFQVL LLDETHRMFFMETGKQMISGLLVKANKSPKAFLESYEDMLQYTQREETWPVSKMELEGRG VVCMNFFDIVLDFILMDAFEDLESPPSSVVAVLRNRWLSDSFKETALATACWSVLKAKRR LLMVPDGFIAHFYVISEHVSPVLAFGFLGPHQHLSEVCTIFKQQIVQYLKDMFDHDKVRF TSVPSLAEDILRLSHRRADILMGYLGIENLPETNGALPKSPCQAESGNLDASGQQD
Protein Length
full length protein
Tag Info
The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulator of mitochondrial fusion: acts by forming homo- and heterodimers at the mitochondrial outer membrane and facilitating the formation of pld6/MitoPLD dimers. May act by regulating phospholipid metabolism via pld6/MitoPLD.
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Protein Families
Mitoguardin family
Database Links

KEGG: dre:541431

UniGene: Dr.38403

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1