Recombinant Danio rerio Selenoprotein N (sepn1)

Code CSB-CF668934DIL
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
selenon
Uniprot No.
Alternative Names
selenon; sepn; sepn1; Selenoprotein N; SePN; SelN
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Region
1-557
Target Protein Sequence
MAADVDKTPAGEQKDDHEDRGTPSSRRGRSRFTQISSLFIIAAIPVIGVCIKYYLDIQFV KRHEAGLKALGADGLFFFSSLDTDHDLYLSPEEFKPIAEKLTGVAPPPEYEEEIPHDPNG ETLTLHAKMQPLLLESMTKSKDGFLGVSHSSLSGLRSWKRPAISSSTFYASQFKVFLPPS GKSAVGDTWWIIPSELNIFTGYLPNNRFHPPTPRGKEVLIHSLLSMFHPRPFVKSRFAPQ GAVACIRATSDFYYDIVFRIHAEFQLNDVPDFPFWFTPGQFAGHIILSKDASHVRDFHIY VPNDKTLNVDMEWLYGASETSNMEVDIGYLPQMELGAEGPSTPSVIYDEQGNMIDSRGEG GEPIQFVFEEIVWSEELRREEASRRLEVTMYPFKKVPYLPFSEAFSRASAEKKLVHSILL WGALDDQSCUGSGRTLRETVLESSPVLALLNQSFISSWSLVKELEDLQGDVKNVELSEKA RLHLEKYTFPVQMMVVLPNGTVVHHINANNFLDQTSMKPEDEGPGLSFSAGFEDPSTSTY IRFLQEGLEKAKPYLES
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in cell protection against oxidative stress and in the regulation of redox-related calcium homeostasis. Regulates the calcium level of the ER by protecting the calcium pump ATP2A2 against the oxidoreductase ERO1A-mediated oxidative damage. Acts as a modulator of ryanodine receptor (RyR) activity: protects RyR from oxidation due to increased oxidative stress, or directly controls the RyR redox state, regulating the RyR-mediated calcium mobilization required for normal muscle development and differentiation. Plays an important role in muscle development and differentiation during early development. Required for development of the slow muscle fiber lineage. Required for the correct organization and attachment of the myofibrils, as well as for the continuity and integrity of the connective tissue that forms the myoseptum.
Gene References into Functions
  1. alteration of myofibril architecture and tendon-like structure in embryos deficient for SelN function provide new insights into the pathological mechanism of SelN-related myopathy PMID: 17123513
  2. sepn1 and ryr1 are required for the same cellular differentiation events and are needed for normal calcium fluxes PMID: 18713863
Subcellular Location
Endoplasmic reticulum membrane.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1