Recombinant Danio rerio Solute carrier family 25 member 43(slc25a43)

Code CSB-CF713167DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5U3V7
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MATVKKDARLTSSQSLMCVGFAGIFSKTVTSPLEVVKILSQVGTFHCKRGFLHSFVLICQ NEGLRAFWKGNMVSCLRLFPYSAIHLATYKNIVNLHIDELGDISQWRAIVAGGLAGISAA LATYPLEVVETRLIAQNCQEPTYRGLLHSLSVIYRNEGLQALYRGFSLTVLGAVPFSVGC YAVYINLDKLWQERHVRFTSLQNFINGCLAAGVAQTLSFPFETVKKKMQAQSLVLPHCGG VDVHFNGMADCFRQVIKNKGVMALWSGLTANMVKIVPYFGLLFSCFEMCKQVCLYRNGYI ISPPSYKLKPGVDQSLGPYELQEFKRYLRNRKSHKAQSSSIGNRW
Source in vitro E.coli expression system
Gene Names slc25a43
Protein Names Recommended name: Solute carrier family 25 member 43
Expression Region 1-345
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family
Database Links

KEGG: dre:796731

STRING: 7955.ENSDARP00000032399

UniGene: Dr.76536

Related Products

slc25a43 Antibodies

slc25a43 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

slc25a43 Proteins

slc25a43 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.