Recombinant Danio rerio Synapse differentiation-inducing gene protein 1-like(syndig1l)

Code CSB-CF729231DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5TZE2
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MESLSELQNPLLDKNSKHMVMADYGYGGDFHSNQYQENIINYFVTGGGGGGGGGGGGGGV AVTGGNGKAKSQLLDATSLHLAVEAFYKPNFILYKDDVSGKGKDYKNECCETTFMEKKDK EVVVETPSTEDPQAKLLDENDVKIQTVSYEVEEEEYVEYETDCSSDSESEDNFIVIPPRD HLGLAIFSMLCCFWPLGIAAFYFSQGTSKAVTKGDFPLASIASRRALFLAALSITIGTGV YVGVVVALIAYLSKPGHI
Source in vitro E.coli expression system
Gene Names syndig1l
Protein Names Recommended name: Synapse differentiation-inducing gene protein 1-like Alternative name(s): Capucin Transmembrane protein 90A
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein, Golgi apparatus, cis-Golgi network
Protein Families CD225/Dispanin family
Database Links

KEGG: dre:555204

STRING: 7955.ENSDARP00000062153

UniGene: Dr.92961

Related Products

syndig1l Antibodies

syndig1l Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

syndig1l Proteins

syndig1l Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.