Recombinant Danio rerio Transmembrane protein 198-B(tmem198b)

Code CSB-CF670978DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q498W5
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MTSTLQTLAFKLAPPSREAGSGQLEPCSDVQGRRYEVVPSVVCSMCCLFGIIYCFFGYRC FKAVLFLTGLMFGSVIIFLLCYKERVLDTQLSVEASVGIGLGIGTLCGLVTMLVRSVGLF MVGLLLGLLVGIGTLIGMEELSSNPPRSVWVPLGVLLGLGMLFAVLTLQWQRCFTTLSTA VFGAAVIVVATDYFVELFALVRYIYERVKTGPREPVCWTTWVVLGAWPALALLGVLVQWR VTAEGYSHTKVMISRQQRRVQLMRIRQKEERRESSRKKKRKQPQSAQHTHAAKALHPEPA YRRKPNPIRRFDGDVLSPSYIQSFRDRQVDGRAYPVGGLMPSGHTSVDMDYDCGSTVPLT AGVGPHVRV
Source in vitro E.coli expression system
Gene Names tmem198b
Protein Names Recommended name: Transmembrane protein 198-B
Expression Region 1-369
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TMEM198 family
Database Links

KEGG: dre:564608

UniGene: Dr.48555

Related Products

tmem198b Antibodies

tmem198b Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

tmem198b Proteins

tmem198b Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.