Recombinant Danio rerio Zinc transporter ZIP13(slc39a13)

Code CSB-CF806319DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8AW42
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MMIQTAVAQAKTAPAGPGPWSIKDLVDLQYLDELMSIDNLDVWFCSLVGSIAIGLSGIFP LLVIPIEAGTALKTEAGCQKLKKLLSFAIGGLLGDVFLHLLPEAWAYTSSPGGSHRHYCT QGLWVIGGLMSFLTLEKMFPDEVGDPETKTSFQRTTSSSSDLSSQFSVSPQTNGICSNNN SDSKPKTDISPYTQPEKIKTSGYLNLLANCIDNFTHGLAVAGSFLVSRKVGFLTTFAILL HEIPHEVGDFAILLRAGFDRWKAARMQLSTALGGVLGACFALCSQSQHGAENATTWILPF TSGGFLYIALVNVVPDLLEETNPRNSLLQVLLLFSGIGVMALLSIAMD
Source in vitro E.coli expression system
Gene Names slc39a13
Protein Names Recommended name: Zinc transporter ZIP13 Alternative name(s): Solute carrier family 39 member 13 Zrt- and Irt-like protein 13 Short name= ZIP-13
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as a zinc-influx transporter.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein
Protein Families ZIP transporter (TC 2.A.5) family
Database Links

KEGG: dre:368686

STRING: 7955.ENSDARP00000107224

UniGene: Dr.75981

Related Products

slc39a13 Antibodies

slc39a13 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

slc39a13 Proteins

slc39a13 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.