Recombinant Dictyostelium discoideum ABC transporter G family member 4(abcG4)

Code CSB-CF837408DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8T689
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence MEDIGNNNFEIIDDKSDEKNDENFEDKNSRNNINEEQILSNQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQEQQQFKNEVINTLHPKQPNNEYSLSSLSLSPQTPQINLSEKLISDNSNL NSNSNNNNKDIESGIQTKIKNIENRRNSINSDSSGTFNNEITNGRSNDNEIININNNVGV QVTFENICYKVLNKKYNEQKKIIKKLESGKIDIEDIESQVNKLPIDRIIEKELTILSNVS GIVEKGEMVALMGPSGSGKSTLLDILANRKSTGTITGKILVNGKEIGEAYKMFCSYVTQE EVFLETSTVYETLKFHADLRLPDMTDTEKDIRIKQVLKDVGLDRKLNSKIGGILPGGMIV KGLSGGEKKRVSIGCALVTNPSLLFLDEPTSGLDSLNSLKVMKVLLELTKMKGVTVVCSV HQPRPEIFYLFSNIMVVLKGRMVYSGSNILEYLSSIDSNYKCPPQMNPADFILDVCDEIV NNPSQYSTTVDTWEKYWKHEIQPTISNDPINIDIPKRVGFIYQYWVCQKRSYQSFVRNRV VFFSKIVIAILIGLLFSACFGTVGYDGLDQNEAQSVSALFFFIITSLNLLPYSSISTFVS IRTLFNSERASKIYHPFPYFIGSMLIEIVSSFFVVLIITTIIYCIVHLRWSFEAYILSLI SFYMVFLASVFMVIAMSNIAGTVDLTFSYCTGVSVVLVLFSGFLVPINSLPDSFGWIHHI DYLFYGFSSIVIIQYRDFEFQCPQPPIPCLYSNGNNLIEFLGLKNWEYNKSIGILTIWIA FFYILAYIGLYKFNKEKR
Source in vitro E.coli expression system
Gene Names abcG4
Protein Names Recommended name: ABC transporter G family member 4 Alternative name(s): ABC transporter ABCG.4
Expression Region 1-798
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Database Links

KEGG: ddi:DDB_G0289657

STRING: 44689.DDB0216252

Related Products

abcG4 Proteins

abcG4 Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.