Recombinant DnaJ homolog dnj-2(dnj-2)

Code CSB-CF615036CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q17433
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Caenorhabditis elegans
Sequence MRSAIAAPILFLLVSFFVQECESVGFAPELYCGLENCYDVLEVNREEFDKQKLAKAYRAL ARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNYDYYLDHPDQRFYNYYQYYR LRAAPKVDLRIVIVGTILIISLFQFLSAKHKFSEAIEYATGVGKFRNMAIKDGIDKGLLE MDRNGKLKKNKGVDNDEVIKQIIIDNLDVTGGYKRESIYDTLAWHTIIFPLTIFRYIKWT ALWYWRFAIQKEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKRNCATW KAERDAAEQEKMAQSGRYKRYKRYMKNAGTISFVDED
Source in vitro E.coli expression system
Gene Names dnj-2
Protein Names Recommended name: DnaJ homolog dnj-2 Alternative name(s): DnaJ domain protein 2
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families DNAJC25 family
Database Links

KEGG: cel:CELE_B0035.2

STRING: 6239.B0035.2

UniGene: Cel.23438

Related Products

dnj-2 Antibodies

dnj-2 Antibodies for Caenorhabditis elegans

dnj-2 Proteins

dnj-2 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.