Recombinant Dog Potassium-transporting ATPase subunit beta(ATP4B)

Code CSB-CF002343DO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P33704
Storage Buffer Tris-based buffer,50% glycerol
Species Canis lupus familiaris (Dog) (Canis familiaris)
Sequence MAALQEKKSCSQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGIFALCIYTLMCTLDPYTPDYQDQLKSPGVTLRPDVYGEKGLDISYNVSDNRTWVDLVNILHNFLEGYSPTSQEDNINCTSEKYFFQDVFGAPNHTKFSCKFMADMLQNCSGLTDPNFGFAEGKPCFIIKMNRIVNFLPSNSTAPRADCTFLDQHKDDRPLQVEYYPPNGTFSLRYFPYYGKKAQPHYSNPLVAAKLLNVPRNTEVLIVCKILADYVTFDNPHDPYEGKVEFKLTIQQ
Source in vitro E.coli expression system
Gene Names ATP4B
Protein Names Recommended name: Potassium-transporting ATPase subunit beta Alternative name(s): Gastric H(+)/K(+) ATPase subunit beta Proton pump beta chain
Expression Region 1-290
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Subcellular Location Cell membrane, Single-pass type II membrane protein
Protein Families X(+)/potassium ATPases subunit beta family
Database Links

KEGG: cfa:404020

STRING: 9615.ENSCAFP00000009569

UniGene: Cfa.3897

Pathway Oxidative Phosphorylation

Related Products

ATP4B Proteins

ATP4B Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.