Recombinant Dog Relaxin receptor 2(RXFP2)

Code CSB-CF723066DO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5XM32
Storage Buffer Tris-based buffer,50% glycerol
Species Canis lupus familiaris (Dog) (Canis familiaris)
Sequence MFPLLHFIVLIDVKDFPLTEGSTITPLCQKGYFPCGNLTKCLPRAFHCDGVDDCGNGADE DNCGDTSGWATIFGTVHGNANNVALTQECFLNQYPQPCDCKGTELECINADLRAVPVISS NTTLLSLKKNKIHSLPDKVFTKYTQLKQIFLQHNCITHISRKAFFGLHNLQILYLSHNCI TTLRPGVFKDLHQLTWLILDDNPITRISQQLFTGLKSLFFLSMVNNYLEALPKQMCAQMP QLNWMDLEGNGIKYLTNSSFLSCNSLTVLFLPRNQIDFVPEKTFSSLKNLGELDLSSNMI MELPPEIFKDLKLLQKLNLSSNPLLYLHKNQFESLKQLQSLDLERIEIPNINTRMFQPMM NLSHIYFKNFRYCSYAPHVRICMPLTDGISSFEDLLANNILRIFVWVIAFITCFGNLFVI GMRSFIKAENTTHATSIKILCCADCLMGVYLFFIGFFDIKYRGQYQKYALLWMESLQCRL MGFLAMLSTEVSVLLLTYLTLEKFLAIVFPFSNIRPGKWQTMVILICIWIVGFLIAVIPF WKEDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLLAFLIIVFSYTIMFCSIK KTALQTSEVRNPIGREVAVANRFFFIVFSDAICWIPVFVIKILSLFRVEIPGTITSWIVI FFLPVNSALNPILYTLTTSFFKDKLKQLLHKHRRKSIFKTKKKSLSTSIVWTDDSSSLKL GVLNKITLGDSIVKPIS
Source in vitro E.coli expression system
Gene Names RXFP2
Protein Names Recommended name: Relaxin receptor 2 Alternative name(s): INSL3 receptor Leucine-rich repeat-containing G-protein coupled receptor 8 Relaxin family peptide receptor 2
Expression Region 1-737
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3) (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: cfa:450220

STRING: 9615.ENSCAFP00000009735

UniGene: Cfa.16241

Related Products

RXFP2 Proteins

RXFP2 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.