Recombinant Drosophila erecta Protein wntless (wls)

Code CSB-CF459258DLK
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
wls
Uniprot No.
Alternative Names
wls; GG13932; Protein wntless
Species
Drosophila erecta (Fruit fly)
Expression Region
36-562
Target Protein Sequence
APLPAGHVTVLGSLCREDHGRQNDTGFLLYSRGAGACIPVTREEVEQDSTKMANELVHVF QMPLPRDLRDLDYSRWQQNLIGVLQVEFGYDSSSELREPPRELQLTIDMRLAYRNKGDPD NGWKLYAHGVEHRYLDCVSSHVGPTETLYSCDMIPLFELGALHHSFYLLNLRFPLDTPSQ MNLQFGHMHDLTLTAIHQNGGFTQIWLLLKTVLFPFVVGIMIWFWRRVHLLQRSPALLEY MLIYLGAALTFLNLPLEYLSLVFEMPYMLLLSDIRQGIFYAMLLTFWLVFAGEHMLIQDA PNKSTIRSRYWKHLSAVVVGCISLFVFDICERGVQLRNPFYSIWAMPLAAKMAMTFIVLA GVSAAIYFLFLCYMIWKVFRNIGDKRTSLPSMSQARRLHYESLIYRFKFLMLATIVCAAL TVTGFIMGQRAEGQWDWNDNVAIQPTSAFLTGVYGMWNIYIFALLILYAPSHKQWPTMHH SDETTQSNENIVASAASEEIEFSHLPSDSNPSEISSLTSFTRKVAFD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
A segment polarity gene required for wingless (wg)-dependent patterning processes, acting in both wg-sending cells and wg-target cells. In non-neuronal cells wls directs wg secretion. The wls traffic loop encompasses the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi, and involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (the larval motorneuron NMJ), the wg signal moves across the synapse via the release of wls-containing exosome-like vesicles. Postsynaptic wls is required for the trafficking of fz2 through the fz2-interacting protein Grip.
Subcellular Location
Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Protein Families
Wntless family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1