Recombinant Drosophila melanogaster GPI mannosyltransferase 4(CG3419)

Code CSB-CF818665DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8MT80
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MRLTTLWQNRSPGDRHLSTYFCFAAVRLLLVFVPQLGYVHPDEFFQSVEVMTGDHFRLEH TRTWEFNNSLPVRSIVLPFALLRIPWSFYEFVAECLKAWWQLELLGTYAYVVFPRLIYTL ISFSNDYCLFRICRLYGLRFEIRLLAMGSSWILLVFGTRTFSNSLEMAMCSWLLCLVSEC MLRTNTVVYKKEFLEEKYDKAESISERVRIWKLKNSLPAHNLQHLMAMSTICVAGVFNRP TFLLFGAPMVFFWLLRGMGTRSITFRDFNLRIALFCLCALPALVLFIFCDSLYYQHLTLG ELHMMHLSIDNFVFTPWNFIKANLDSAQTASHGVHPCYVHLMVNMPMLFNVLALASLGAF AQLLLRFFRAEYQVLPRFQSIVSLMSGAIFVPLFFLSLINHQEPRFLLPVTFPLILLHAP KLITGFSAKYPFQKDHPLLRLFYDKLLSSKASGPYLLKIWYVSNVALTLFFGFIHQAGVY PLAADISHVIATKPAATHVHLITSHIYSLPLHLINIPSSRVLHFNRLTHQRYRRPRDFYM YEYGGLPLDSLLQKVKLISGSCEVKKSGPSRRRYKLYLAIPASLSADLHEALVHSNASSY LNFELLKVFYPHLSTEAFPHLQGRHPCDVDAPHWAHDDLRGTCSAEQLPAFSFAYLNKQF SSFVHQLGLALYEIDVTRNKPRSVVIKKASMTETAA
Source in vitro E.coli expression system
Gene Names PIG-Z
Protein Names Recommended name: GPI mannosyltransferase 4 EC= 2.4.1.- Alternative name(s): GPI mannosyltransferase IV Short name= GPI-MT-IV
Expression Region 1-696
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers a fourth mannose to some trimannosyl-GPIs during GPI precursor assembly (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 22 family, PIGZ subfamily
Database Links

KEGG: dme:Dmel_CG45068

STRING: 7227.FBpp0072198

UniGene: Dm.13579

Related Products

PIG-Z Antibodies

PIG-Z Antibodies for Drosophila melanogaster (Fruit fly)

PIG-Z Proteins

PIG-Z Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.