Recombinant Drosophila melanogaster Neuropeptide Y receptor(NepYr)

Code CSB-CF329588DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25931
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Drosophila melanogaster (Fruit fly)
Sequence MEHHNSHLLPGGSEKMYYIAHQQPMLRNEDDNYQEGYFIRPDPASLIYNTTALPADDEGS NYGYGSTTTLSGLQFETYNITVMMNFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFAL IGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCH FVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIP IVSGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIR VWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDP LPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSVGDRMNAT SGTGPALPLNRMNTSTTYISARRKPRATSLRANPLSCGETSPLR
Source in vitro E.coli expression system
Gene Names RYa-R
Protein Names Recommended name: Neuropeptide Y receptor Short name= NPY-R Alternative name(s): PR4 receptor
Expression Region 1-464
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the neuropeptides RYamide-1 and RYamide-2
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: dme:Dmel_CG5811

STRING: 7227.FBpp0084470

Related Products

RYa-R Antibodies

RYa-R Antibodies for Drosophila melanogaster (Fruit fly)

RYa-R Proteins

RYa-R Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.