Recombinant Drosophila melanogaster Neuropeptide Y receptor(NepYr)

Code CSB-CF329588DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25931
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MEHHNSHLLPGGSEKMYYIAHQQPMLRNEDDNYQEGYFIRPDPASLIYNTTALPADDEGS NYGYGSTTTLSGLQFETYNITVMMNFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFAL IGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCH FVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIP IVSGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIR VWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDP LPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSVGDRMNAT SGTGPALPLNRMNTSTTYISARRKPRATSLRANPLSCGETSPLR
Source in vitro E.coli expression system
Gene Names RYa-R
Protein Names Recommended name: Neuropeptide Y receptor Short name= NPY-R Alternative name(s): PR4 receptor
Expression Region 1-464
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the neuropeptides RYamide-1 and RYamide-2
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: dme:Dmel_CG5811

STRING: 7227.FBpp0084470

Related Products

RYa-R Antibodies

RYa-R Antibodies for Drosophila melanogaster (Fruit fly)

RYa-R Proteins

RYa-R Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.