Recombinant Drosophila melanogaster Odorant receptor 23a(Or23a)

Code CSB-CF305630DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P81912
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Drosophila melanogaster (Fruit fly)
Sequence MKLSETLKIDYFRVQLNAWRICGALDLSEGRYWSWSMLLCILVYLPTPMLLRGVYSFEDP VENNFSLSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHL LRMSKLFQITYAVVFIIAAVPFVFETELSLPMPMWFPFDWKNSMVAYIGALVFQEIGYVF QIMQCFAADSFPPLVLYLISEQCQLLILRISEIGYGYKTLEENEQDLVNCIRDQNALYRL LDVTKSLVSYPMMVQFMVIGINIAITLFVLIFYVETLYDRIYYLCFLLGITVQTYPLCYY GTMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHLSTYVAC WKGAYSFFTLMADRDGLGS
Source in vitro E.coli expression system
Gene Names Or23a
Protein Names Recommended name: Odorant receptor 23a
Expression Region 1-379
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Tissue Specificity Expressed in 10-40 sensory cells in the third antenna segment and in the maxillary palp.
Database Links

KEGG: dme:Dmel_CG9880

STRING: 7227.FBpp0077382

UniGene: Dm.21525

Related Products

Or23a Antibodies

Or23a Antibodies for Drosophila melanogaster (Fruit fly)

Or23a Proteins

Or23a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.