Recombinant Drosophila melanogaster Odorant receptor 33a(Or33a)

Code CSB-CF305548DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P81914
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MDSRRKVRSENLYKTYWLYWRLLGVEGDYPFRRLVDFTITSFITILFPVHLILGMYKKPQ IQVFRSLHFTSECLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRV ARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSS LLILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLM KIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSC YYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFF ATVRMAYSFYTLALSFRV
Source in vitro E.coli expression system
Gene Names Or33a
Protein Names Recommended name: Odorant receptor 33a
Expression Region 1-378
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Tissue Specificity Expressed in 1-2 cells on the distal edge of the antenna but not the maxillary palp.
Database Links

KEGG: dme:Dmel_CG16960

STRING: 7227.FBpp0079862

UniGene: Dm.26795

Related Products

Or33a Antibodies

Or33a Antibodies for Drosophila melanogaster (Fruit fly)

Or33a Proteins

Or33a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.