Recombinant Drosophila melanogaster Odorant receptor 33c(Or33c)

Code CSB-CF305928DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P81916
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MVIIDSLSFYRPFWICMRLLVPTFFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPS TAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHC HARRFTRCLYISFGMIYALFLFGVFVQVISGNWELLYPAYFPFDLESNRFLGAVALGYQV FSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHK LLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLF PSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELN LNAFFATLKMAYSLFAVVVRAKGI
Source in vitro E.coli expression system
Gene Names Or33c
Protein Names Recommended name: Odorant receptor 33c
Expression Region 1-384
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Tissue Specificity Expressed in the antenna and in a subset of 18 olfactory receptor neurons in the maxillary palp.
Database Links

KEGG: dme:Dmel_CG5006

UniGene: Dm.26797

Related Products

Or33c Antibodies

Or33c Antibodies for Drosophila melanogaster (Fruit fly)

Or33c Proteins

Or33c Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.