Recombinant Drosophila melanogaster Odorant receptor 43a(Or43a)

Code CSB-CF305477DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P81917
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MTIEDIGLVGINVRMWRHLAVLYPTPGSSWRKFAFVLPVTAMNLMQFVYLLRMWGDLPAF ILNMFFFSAIFNALMRTWLVIIKRRQFEEFLGQLATLFHSILDSTDEWGRGILRRAEREA RNLAILNLSASFLDIVGALVSPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPLL LSMMYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGEEQSEEERFQRLASCIAYHTQVMRY VWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLFTYYNRA NEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLL NASYSYFTMLRGVTGK
Source in vitro E.coli expression system
Gene Names Or43a
Protein Names Recommended name: Odorant receptor 43a
Expression Region 1-376
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. Complexes with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. They are necessary and sufficient to promote functional reconstitution of odor-evoked signaling in sensory neurons that normally respond only to carbon dioxide. Involved in the behavioral responses to acetophenone, benzaldehyde, benzyl alcohol, cyclohexanone, and cyclohexanol.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or30a subfamily
Tissue Specificity Expressed with Orco in 20 sensory neurons on the distal edge of the antenna.
Database Links

KEGG: dme:Dmel_CG1854

STRING: 7227.FBpp0088122

UniGene: Dm.2588

Related Products

Or43a Antibodies

Or43a Antibodies for Drosophila melanogaster (Fruit fly)

Or43a Proteins

Or43a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.