Code | CSB-CF305477DLU |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | Or43a |
Uniprot No. | P81917 |
Species | Drosophila melanogaster (Fruit fly) |
Expression Region | 1-376 |
Target Protein Sequence | MTIEDIGLVGINVRMWRHLAVLYPTPGSSWRKFAFVLPVTAMNLMQFVYLLRMWGDLPAF ILNMFFFSAIFNALMRTWLVIIKRRQFEEFLGQLATLFHSILDSTDEWGRGILRRAEREA RNLAILNLSASFLDIVGALVSPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPLL LSMMYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGEEQSEEERFQRLASCIAYHTQVMRY VWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLFTYYNRA NEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLL NASYSYFTMLRGVTGK |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. Complexes with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. They are necessary and sufficient to promote functional reconstitution of odor-evoked signaling in sensory neurons that normally respond only to carbon dioxide. Involved in the behavioral responses to acetophenone, benzaldehyde, benzyl alcohol, cyclohexanone, and cyclohexanol. |
Subcellular Location | Cell membrane, Multi-pass membrane protein |
Protein Families | Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or30a subfamily |
Tissue Specificity | Expressed with Orco in 20 sensory neurons on the distal edge of the antenna. |
Database Links |
KEGG: dme:Dmel_CG1854 STRING: 7227.FBpp0088122 UniGene: Dm.2588 |
Recombinant Human Keratin, type II cytoskeletal 4(KRT4)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Methionine aminopeptidase 2(METAP2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Sulfotransferase 1A1(Sult1a1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Cytochrome c-type heme lyase(HCCS)
Express system: E.coli
Species: Homo sapiens (Human)