Recombinant Drosophila melanogaster Odorant receptor 47a(Or47a)

Code CSB-CF305549DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P81921
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MDSFLQVQKSTIALLGFDLFSENREMWKRPYRAMNVFSIAAIFPFILAAVLHNWKNVLLL ADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQGEEYAEILNAANKQDQ RMCTLFRTCFLLAWALNSVLPLVRMGLSYWLAGHAEPELPFPCLFPWNIHIIRNYVLSFI WSAFASTGVVLPAVSLDTIFCSFTSNLCAFFKIAQYKVVRFKGGSLKESQATLNKVFALY QTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGYLFSITFAQTEGVYYASFIATIIIQAY IYCYCGENLKTESASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAHRGFRITGYFF EANMEAFSSIVRTAMSYITMLRSFS
Source in vitro E.coli expression system
Gene Names Or47a
Protein Names Recommended name: Odorant receptor 47a
Expression Region 1-385
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. Complexes with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. They are necessary and sufficient to promote functional reconstitution of odor-evoked signaling in sensory neurons that normally respond only to carbon dioxide. Involved in the behavioral responses to esters. Involved in the behavioral responses to pentyl acetate.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or1a subfamily
Tissue Specificity Expressed with Orco in 40 olfactory receptor neurons in a broad area across the antenna, including both anterior and posterior faces. This expression pattern matches the distribution of the small sensilla basiconica. Expression in the antenna is observed
Database Links

KEGG: dme:Dmel_CG13225

STRING: 7227.FBpp0087212

UniGene: Dm.2583

Related Products

Or47a Antibodies

Or47a Antibodies for Drosophila melanogaster (Fruit fly)

Or47a Proteins

Or47a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.