Recombinant Drosophila melanogaster Odorant receptor 47b(Or47b)

Code CSB-CF305632DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P81922
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MNDSGYQSNLSLLRVFLDEFRSVLRQESPGLIPRLAFYYVRAFLSLLCQYPNKKLASLPL YRWINLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCDEID ELISDFEYYNRELRPHNIDEEVLGWQRLCYVIESGLYINCFCLVNFFSAAIFLQPLLGEG KLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKL LCIEIRKLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISI STFETMAAAAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTK SPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQESM
Source in vitro E.coli expression system
Gene Names Or47b
Protein Names Recommended name: Odorant receptor 47b
Expression Region 1-412
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Plays an important role in sociosexual interactions since its enhances courtship in a pheromone-dependent manner.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or49a subfamily
Tissue Specificity Expressed in olfactory sensory neurons in the antenna.
Database Links

KEGG: dme:Dmel_CG13206

STRING: 7227.FBpp0087262

UniGene: Dm.26901

Related Products

Or47b Antibodies

Or47b Antibodies for Drosophila melanogaster (Fruit fly)

Or47b Proteins

Or47b Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.