Recombinant Drosophila melanogaster Otefin (Ote)

Code CSB-CF321785DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ote
Uniprot No.
Alternative Names
Ote; CG5581; Otefin; LEM domain-containing protein Otefin
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-424
Target Protein Sequence
MADVDDFDSLSNAELRAKMLAQGLPNIPVTDSSRKVLVKRLRASIGGQASPAASPKKTNR RETLAPAPGAPSAPAAASTPVDKLDGNKVAPATKARRTITAAEAKEPVRRLPEEAIRRRP DEADRLRSEEPVAARKPTTAPAAQPVQTRRTSTSSGSERKVVEPLRKPETIVEQPASSKR ADREENYLKVNSLIVLESDEEEDEQLVQAADLVEQEHAARQKTTKLASSGTTTYEYKSKV VEPPRRQVYEATAAPVLPPSVPSARAQTTSSTRSYDYASNPAPGRYSSFVRTAAQGYVTA EAPPVASYSSSYKRTYANELSDDTDSKEDQYESTFARNLARLRAERIGDRISPYSRRTLA SGNAGSGSLGYEPRARRSLRPNDNSVSEAFNRWLNSLEQKYHIKSKLFIVLLVLLLIGVY YIFY
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inner nuclear membrane protein. Involved in the attachment of membrane vesicles to chromatin during nuclear assembly, and is probably required for centrosome maturation and cell cycle progression during mitosis. Essential for differentiation of certain tissues and the maintenance of progenitor cell populations. Required for the differentiation and maintenance of male and female germline stem cells (GSCs), as well as the maintenance of somatic cells in the GSC niche. This role is likely to be independent of the BMP (Dpp) pathway that negatively regulates bam transcription during GSC differentiation. During development, plays essential and redundant functions with the other LEM domain proteins; bocks and MAN1. Also has a redundant but important role with bocks during larval development.
Gene References into Functions
  1. Ote is required autonomously for survival of male and female stem cell populations, as well as non-autonomously for maintenance of two somatic niches. Ote loss in ovary causes a decrease in cap cell number and altered signal transduction. Ote mutant males become prematurely sterile as they age. PMID: 27174470
  2. production of Bocks, but not dMAN1, rescued ote-/- sterility, demonstrating that Ote and Bocks are functional homologs PMID: 24700158
  3. We show that the primary defect in ote(-/-) GSCs is a block of differentiation, which ultimately leads to germ cell death. PMID: 23806619
  4. Phosphorylation of Ote at T63 is critical for mitotic progression. PMID: 22751930
  5. Data show that otefin is essential for germline stem cell (GSC) maintenance, is required for the Dpp/BMP signaling pathway to silence bam transcription, and that Ote physically interacts with Medea/Smad4 at the bam silencer element to regulate GSC fate. PMID: 18410727

Show More

Hide All

Subcellular Location
Nucleus inner membrane; Peripheral membrane protein; Nucleoplasmic side. Nucleus, nucleoplasm. Cytoplasm. Chromosome. Cytoplasm, cytoskeleton, spindle pole. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Tissue Specificity
Expressed in all cell types of the germarium and testis. Expressed in nurse cells, follicle cells and oocytes.
Database Links

KEGG: dme:Dmel_CG5581

STRING: 7227.FBpp0085947

UniGene: Dm.3658

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×