Recombinant Drosophila melanogaster Phosphatidate cytidylyltransferase, photoreceptor-specific (CdsA)

Code CSB-CF345151DLU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CdsA
Uniprot No.
Alternative Names
Cds; CdsA; CG7962; Phosphatidate cytidylyltransferase, photoreceptor-specific; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-447
Target Protein Sequence
MAEVRRRKGEDEPLEDTAISGSDAANKRNSAADSSDHVDSEEEKIPEEKFVDELAKNLPQ GTDKTPEILDSALKDLPDRWKNWVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCF QEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINRVEYLKFLVTYH RFLSFALYIIGFVWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFI VPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQY FICPIQYSEEQGRMTMSCVPSYLFTPQEYSLKLFGIGKTLNLYPFIWHSISLSLFSSIIG PFGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPSPAKLL TQIYNLKPDQQYQIYQSLKDNLGDMLT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the conversion of phosphatidic acid (PA) to CDP-diacylglycerol (CDP-DAG), an important precursor for the synthesis of phosphatidylinositol (PtdIns) and phosphatidylglycerol (PG). Required for the regeneration of the signaling molecule phosphatidylinositol 4,5-bisphosphate (PtdInsP2) from PA and maintenance of its steady supply during signaling thus playing an essential role during phospholipase C-mediated transduction. In the salivary glands and possibly other adipose tissues, function is essential for regulating cell growth and neutral lipid storage by coordinating PtdIns metabolism and insulin pathway activity. Acts by positively regulating activity of the insulin pathway through synthesis of PtdIns, and in turn the insulin pathway up-regulates the synthesis of CdsA. This CdsA-insulin positive feedback loop may be one of the mechanisms for coordinating cell growth and fat storage; switching to fat storage when cells reach homeostasis or converting from growth to fat storage under nutrient-poor conditions. Required for spermatid individualization by regulating lipid compositions and lipid-mediated signaling during spermatogenesis.
Gene References into Functions
  1. The results of lipidomic and genetic analyses of the CdsA mutant highlight the importance of correct lipid composition during sperm development and show that phosphatidic acid levels are crucial in late stages of spermatogenesis. PMID: 26791243
  2. Overexpressing CdsA rescues the fat storage and cell growth phenotypes of insulin pathway mutants, suggesting that CdsA coordinates cell/tissue growth and lipid storage through the insulin pathway. PMID: 24603715
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
CDS family
Tissue Specificity
Retina. Localized to the photoreceptor neurons, both in the compound eyes and ocelli.
Database Links

KEGG: dme:Dmel_CG7962

STRING: 7227.FBpp0076411

UniGene: Dm.6770

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X