Recombinant Drosophila melanogaster Post-GPI attachment to proteins factor 2-like(CG7990)

Code CSB-CF894286DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9VWK6
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MQQSTGAATSSAADSGMGATDLVSRCVGDGGGGGGNSCSGGSSDPAAVRALYRCCALTKT KHSTTNYGQINTTISSKQADAREPQEQQVAIHYLASFHELCVVTALLPLVTLFTCFVTAY VFQYDDVHETHCRVYNIIPSISAITGVSPQRYFWRFSIALHIGPRIPIAFVYKNYYRSQL RRISPAQVPQTSLLITLILVLNCIEIASLGGVTYISNRENYPVHERIFITFMVCSLCYML ATIKLNGILNAGQALSEKQLLSIKWKKILFAVSILSTVGLLVFFAKHRFYCHDLAFSWFA FFEYLIAIANMLFHFTIIWDFPSQFMMIVQGPRENLAQYLSNRPKLD
Source in vitro E.coli expression system
Gene Names CG7990
Protein Names Recommended name: Post-GPI attachment to proteins factor 2-like
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families PGAP2 family
Database Links

KEGG: dme:Dmel_CG7990

STRING: 7227.FBpp0074464

UniGene: Dm.17290

Related Products

CG7990 Antibodies

CG7990 Antibodies for Drosophila melanogaster (Fruit fly)

CG7990 Proteins

CG7990 Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.