Recombinant Drosophila melanogaster Post-GPI attachment to proteins factor 3(CG3271)

Code CSB-CF765958DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7K0P4
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence SNGDRTQFFHNCRQNCERTNCSADGLEIQEQAVKFYQQSVFDRLFQWSCADECQYGCMWR TVFAFFERGWPIPQFYGKWPFLRLLGMQEPASVIFSCLNFVVHLRLLRKFRREVRPDSPC YMLTHIFAVTSLNGWIWSAIFHTRDFPLTELLDYAFAYSIILCSLYVMVMRMLHRYSLFL RGVITLAFLSYYINYFAYLSVGRFNYAFNMMVNVATGVIAAVGWFVWCHFVRTRRPYFRR ILRFYILMALAMSLELLDFPPILWILDAHALWHLATIPLASLYYECVEILLYSNIATCVC ILAS
Source in vitro E.coli expression system
Gene Names PGAP3
Protein Names Recommended name: Post-GPI attachment to proteins factor 3
Expression Region 23-326
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the lipid remodeling steps of GPI-anchor maturation.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein
Protein Families PGAP3 family
Database Links

KEGG: dme:Dmel_CG3271

UniGene: Dm.495

Related Products

PGAP3 Antibodies

PGAP3 Antibodies for Drosophila melanogaster (Fruit fly)

PGAP3 Proteins

PGAP3 Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.