Recombinant Drosophila melanogaster Potassium voltage-gated channel protein Shaker (Sh)

Code CSB-CF357413DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Sh
Uniprot No.
Alternative Names
Sh; mns; CG12348; Potassium voltage-gated channel protein Shaker; Protein minisleep
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-655
Target Protein Sequence
MAAVAGLYGLGEDRQHRKKQQQQQQHQKEQLEQKEEQKKIAERKLQLREQQLQRNSLDGY GSLPKLSSQDEEGGAGHGFGGGPQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPD TLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFY ELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLS IVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLA CPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAI LRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAG SENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSN FNYFYHRETDQEEMQSQNFNHVTSCPYLPGTLGQHMKKSSLSESSSDMMDLDDGVESTPG LTETHPGRSAVAPFLGAQQQQQQPVASSLSMSIDKQLQHPLQQLTQTQLYQQQQQQQQQQ QNGFKQQQQQTQQQLQQQQSHTINASAAAATSGSGSSGLTMRHNNALAVSIETDV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Forms rapidly inactivating tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient and may contribute to A-type currents. Plays a role in the regulation of sleep need or efficiency. Plays a role in sexual behavior, where it is imortant for male sex discrimination.
Gene References into Functions
  1. S4-S5 linker movement during activation and inactivation in voltage-gated K(+) channels. PMID: 29959207
  2. Authors provide evidence that in the Drosophila Shaker voltage-gated K(+) channels the S3 domain acts as an extracellular hydrophobic 'stabilizer' for the S4 domain biasing the gating chemical equilibrium toward the open state. PMID: 23542156
  3. This study demonstrates that Shaker is not always a good model for Kv1 channels for ligand binding. PMID: 23398369
  4. The xenon requirement in Drosophila melanogaster is not influenced by a single gene mutation at the shaker locus, whereas a reduced expression of a nonselective cation channel leads to an increased xenon requirement. PMID: 22761550
  5. Data show several strong Cysteine-Cadmium-Cysteine bridges in Shaker potassium channel. PMID: 22538811
  6. Synaptic transmission at the larval neuromuscular junction and the transient Shaker potassium current IA in larval muscles have been characterized. PMID: 20429677
  7. interaction of the voltage-dependent Shaker potassium channel with the channel-blocking toxin kappa-conotoxin-PVIIA PMID: 11820396
  8. Shaker K+ channels contribute to the information capacity of Drosophila photoreceptors PMID: 12571596
  9. Second-order kernels of Shaker potassium channel mutants lack a large, early amplification and demonstrate a novel role for Shaker K+ channels in amplifying and accelerating the voltage response of wild-type photoreceptors. PMID: 12761281
  10. Results suggest that the external TEA binding site is not within the membrane electric field and that the voltage dependence of TEA block in K+ solutions arises through a coupling with the movement of K+ ions through part of the membrane electric field. PMID: 12885878
  11. reduce the metabolic cost of neural information in Drosophila photoreceptors. PMID: 12952637
  12. The Shaker voltage-gated potassium channel pore opens when the inner helix bends at a conserved glycine gating hinge. PMID: 15491131
  13. Shaker, which encodes a voltage-dependent potassium channel controlling membrane repolarization and transmitter release, may thus regulate sleep need or efficiency; short-sleeping Shaker flies have a reduced lifespan PMID: 15858564
  14. observations highlight crucial control of nerve terminal excitability by Shaker & Shab channels to confer temporal patterns of synaptic transmission & suggest participation of these channels in activity-dependent synaptic plasticity PMID: 16763031
  15. ShB(delta)K wes activated by binding with toxin 6-bromo-2-mercaptotryptamine (BrMT). PMID: 16801385
  16. These results suggest that cooperative insertion of the voltage-sensor transmembrane helices is a property common to K(v) channels and that the degree of cooperativity depends on a balance between electrostatic and hydrophobic forces. PMID: 17488813
  17. synaptic strength and synaptic strength at neuromuscular junctions along the dorsal-ventral differentials at physiological Ca(2+) levels were not significantly altered in slowpoke (slo) and Shaker (Sh) mutants PMID: 18539401
  18. allosteric communication across disparate regions of the channel protein and between evolved and regulated amino acid changes introduced by RNA editing. PMID: 19114634

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Shaker sub-subfamily
Database Links

KEGG: dme:Dmel_CG12348

STRING: 7227.FBpp0088599

UniGene: Dm.7088

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1