Recombinant Drosophila melanogaster Putative gustatory receptor 22b(Gr22b)

Code CSB-CF306152DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P84180
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MFGSSREIRPYLARQMLKTTLYGSWLLGIFPFTLDSGKRIRQLRRSRCLTLYGLVLNYFL IFTLIRLAFEYRKHKLEAFKRNPVLEMINVVIGIINVLSALIVHFMNFWGSRKVGEICNE LLILEYQDFEGLNGRNCPNFNCFVIQKCLTILGQLLSFFTLNFALPGLEFHICLVLLSCL MEFSLNLNIMHYHVGVLLIYRYVWLINEQLKDLVSQLKLNPETDFSRIHQFLSLYKRLLE LNRKLVIAYEYQMTLFIIAQLSGNIVVIYFLIVYGLSMRTYSIFLVAFPNSLLINIWDFW LCIAACDLTEKAGDETAIILKIFSDLEHRDDKLEMSVNEFAWLCSHRKFRFQLCGLFSMN CRMGFKMIITTFLYLVYLVQFDYMNL
Source in vitro E.coli expression system
Gene Names Gr22b
Protein Names Recommended name: Putative gustatory receptor 22b
Expression Region 1-386
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates (By similarity). Seems to be involved in the sensing of bitter taste since it is expressed in neurons that mediate sensitivity to bitter compounds.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Tissue Specificity Expressed in taste bristles in the foreleg and labial palps. In larvae, is expressed in neurons of the dorsal and posterior pharyngeal sense organs. Expressed in taste neurons that mediate sensitivity to bitter compounds.
Database Links

KEGG: dme:Dmel_CG31931

STRING: 7227.FBpp0099546

UniGene: Dm.30798

Related Products

Gr22b Antibodies

Gr22b Antibodies for Drosophila melanogaster (Fruit fly)

Gr22b Proteins

Gr22b Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.