Recombinant Drosophila melanogaster Putative gustatory receptor 22d(Gr22d)

Code CSB-CF307161DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P84181
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MFRPRCGLRQKFVYVILKSILYSSWLLGIFPFKYEPKKRRLRRSMWLIPFGVVISSSLLI LMVKQSAEDREHGIMLDVFQRNALLYQISSLMGVVGVVSICTVHLRTLWRSKHLEEIYNG LMLLEAKYFCSNAVECPAFDGYVIQKGVVIVVGLLAPWMVHFGMPDSKLPVLNVLVVSMV KLGTLLLALHYHLGVVIIYRFVWLINRELLSLVCSLRGNHKGSSSRVRFLLKLYNKLVNL YSKLADCYDCQTVLMMAIFLAANIIVCFYMIVYRISLSKMSFFVMLIMFPLAIANNFMDF WLSMKVCDLLQKTGRQTSMILKLFNDIENMDKDLEISISDFALYCSHRRFKFLHCGLFHV NREMGFKMFVASVLYLLYLVQFDYMNL
Source in vitro E.coli expression system
Gene Names Gr22d
Protein Names Recommended name: Putative gustatory receptor 22d
Expression Region 1-387
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Tissue Specificity Expressed in neurons of the dorsal pharyngeal sense organs of larvae.
Database Links

STRING: 7227.FBpp0301799

Related Products

Gr22d Antibodies

Gr22d Antibodies for Drosophila melanogaster (Fruit fly)

Gr22d Proteins

Gr22d Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.