Recombinant Drosophila melanogaster Putative gustatory receptor 22e(Gr22e)

Code CSB-CF349273DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P58953
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Drosophila melanogaster (Fruit fly)
Sequence MFRPSGSGYRQKWTGLTLKGALYGSWILGVFPFAYDSWTRTLRRSKWLIAYGFVLNAAFI LLVVTNDTESETPLRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNE LEDLQHRYFRNYSLEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQFFIGLGSL CLMLLAVLLGASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVESERMDLLLYLYHRL LDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSISLNKSLDFKILVFVQALVINML DFWLNVEICELAERTGRQTSTILKLFNDIENIDEKLERSITDFALFCSHRRLRFHHCGLF YVNYEMGFRMAITSFLYLLFLIQFDYWNL
Source in vitro E.coli expression system
Gene Names Gr22e
Protein Names Recommended name: Putative gustatory receptor 22e
Expression Region 1-389
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates. Seems to be involved in the sensing of bitter taste since it is expressed in neurons that mediate sensitivity to bitter compounds which are also avoidance-type taste neurons.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Tissue Specificity Taste bristles on the labial palp, labral and cibarial sense organs, chemosensory bristles on the leg and anterior wing margin. In larvae, is expressed in neurons of the terminal external chemosensory organ and in the dorsal pharyngeal sense organ. Neuron
Database Links

KEGG: dme:Dmel_CG31936

STRING: 7227.FBpp0077556

UniGene: Dm.26374

Related Products

Gr22e Antibodies

Gr22e Antibodies for Drosophila melanogaster (Fruit fly)

Gr22e Proteins

Gr22e Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.