Recombinant Drosophila melanogaster Putative gustatory receptor 22f(Gr22f)

Code CSB-CF348428DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P58954
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MKMFQPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLA MCLAMSSHLASKQRRKYNAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIAN ELLTLEGQVKDLLTLKNCPNFNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCL PSVGLQLIIMHFHTEIILVYRYVWLVNETLEDSHHLSSSRIHALASLYDRLLKLSELVVA CNDLQLILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIINFWDFWLNIVVCDL AGKCGDQTSKVLKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMI ITSFLYLVYLLQFDFMNL
Source in vitro E.coli expression system
Gene Names Gr22f
Protein Names Recommended name: Putative gustatory receptor 22f
Expression Region 1-378
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Tissue Specificity Taste bristles in the foreleg and labial palps.
Database Links

KEGG: dme:Dmel_CG31932

STRING: 7227.FBpp0077568

UniGene: Dm.26355

Related Products

Gr22f Antibodies

Gr22f Antibodies for Drosophila melanogaster (Fruit fly)

Gr22f Proteins

Gr22f Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.