Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoform B(Gr23a)

Code CSB-CF307339DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P83292
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MFPPTRVQASSRVVLKIFHFILVAFSLRSRRLSRLVLWLQFLGWLTWFISMWTQSVIYAQ TIDCTLDCSLRHILTFFQTVSHAFIVVTSFLDGFRIKQDQLDEPIAFEDSDPWLAFTVLA MLVPTLGVEYLVCSNAPEYAFRIRIYHLKTLPSFLALQVQIISFILEVMKVNIRVRQTKL QLLILARELSCRWPQRKQKPQFSDQQAHRVKDLKRRYNDLHYLFVRINGYFGGSLLTIII VHFAIFVSNSYWLFVDIRTRPWRIYAILLNLGFIFNVALQMAAACWHCQQSYNLGRQIGC LISKLVKPQGSKLYNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAAVVTYLVILI QFMFAERSSTRGSG
Source in vitro E.coli expression system
Gene Names Gr23a
Protein Names Recommended name: Putative gustatory receptor 23a, isoform B
Expression Region 1-374
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr2a subfamily
Tissue Specificity Expressed in the adult labellar chemosensory neurons and labral sense organ. Expressed in neurons of the dorsal pharyngeal sense organ of larvae.
Database Links

KEGG: dme:Dmel_CG15396

STRING: 7227.FBpp0077386

UniGene: Dm.26713

Related Products

Gr23a Antibodies

Gr23a Antibodies for Drosophila melanogaster (Fruit fly)

Gr23a Proteins

Gr23a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.