Recombinant Drosophila melanogaster Putative gustatory receptor 39a, isoform D(Gr39a)

Code CSB-CF348430DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P58958
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MKRNAFEELRVQLRTLKWLGVLRFTIDFNKCLVRENASEERSAWLYLIGVVGITCSLIVY STYFPSHFIMGKHNTTGNCYALINIRSCSIVTMLIYTQLYIQRFRFVALLQSILRFNQIS GSHREEGRFAFYYYTHLSLLIICMLNYAYGYWTAGVRLTTIPIYLLQYGFSYLFLGQVVV LFACIQQILLSILKYYNQVVLKNIKSSKESREFYYNFCKYNQVIWLSYTEINHCFGLLLL LVTGLILLITPSGPFYLVSTIFEGRFRQNWQFSLMSFTAILWSLPWIVLLVLAMGRNDVQ KEANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFT YMVILVQFKEMENSTKSINKF
Source in vitro E.coli expression system
Gene Names Gr39a
Protein Names Recommended name: Putative gustatory receptor 39a, isoform D
Expression Region 1-381
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates. Plays a role in sustaining courtship behavior in males, possibly through the reception of a stimulating arrestant pheromone.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Tissue Specificity Expressed in the adult labellar chemosensory neurons and adult thorax and abdomen.
Database Links

UniGene: Dm.27684

Related Products

Gr39a Antibodies

Gr39a Antibodies for Drosophila melanogaster (Fruit fly)

Gr39a Proteins

Gr39a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.