Recombinant Drosophila melanogaster Putative gustatory receptor 39b(Gr39b)

Code CSB-CF348431DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P58960
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MLYSFHPYLKYFALLGLVPWSESCAQSKFVQKVYSAILIILNAVHFGISIYFPQSAELFL SLMVNVIVFVARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGRLKWQSY AKILALGIGFLVTVLPSIYVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLL GIRLQNVLECHLMGANCTLDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGWSILGT YVVLFSDSTVNIYWTQQVLVEVYEYKYLYATFSVFVPSFFNILVFCRCGEFCQRQSVLIG SYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYL IVLMQFSSV
Source in vitro E.coli expression system
Gene Names Gr39b
Protein Names Recommended name: Putative gustatory receptor 39b
Expression Region 1-369
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates (By similarity). Has also atypical sensory function in organ not limited to conventional taste sensing like abdominal ganglions.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr2a subfamily
Tissue Specificity Expressed in the adult labellar chemosensory neurons and in abdominal ganglions. In larvae, is expressed in neurons of the dorsal and posterior pharyngeal sense organs.
Database Links

KEGG: dme:Dmel_CG31620

STRING: 7227.FBpp0081050

UniGene: Dm.26353

Related Products

Gr39b Antibodies

Gr39b Antibodies for Drosophila melanogaster (Fruit fly)

Gr39b Proteins

Gr39b Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.