Recombinant Drosophila melanogaster Putative gustatory receptor 57a(Gr57a)

Code CSB-CF892696DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9V969
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MAVLYFFREPETVFDCAAFICILQFLMGCNGFGIRRSTFRISWASRIYSMSVAIAAFCCL FGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRHLGIYQRL AALDARLMSDFGANLNYRKMLRKNIAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALC YTIVTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQ ELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGYL ALVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQAK IQFTSGLDVVLSRKVIGLFTSILVNYLLILIQFAMTQKMGEQIEQQKIALQEWIGF
Source in vitro E.coli expression system
Gene Names Gr57a
Protein Names Recommended name: Putative gustatory receptor 57a
Expression Region 1-416
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr57a subfamily
Tissue Specificity In larvae, is expressed in neurons of the terminal external chemosensory organ as well as in the dorsal pharyngeal sense organ.
Database Links

KEGG: dme:Dmel_CG13441

STRING: 7227.FBpp0085554

UniGene: Dm.26980

Related Products

Gr57a Antibodies

Gr57a Antibodies for Drosophila melanogaster (Fruit fly)

Gr57a Proteins

Gr57a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.