Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF892696DLU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q9V969 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Drosophila melanogaster (Fruit fly) |
| Sequence | MAVLYFFREPETVFDCAAFICILQFLMGCNGFGIRRSTFRISWASRIYSMSVAIAAFCCL FGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRHLGIYQRL AALDARLMSDFGANLNYRKMLRKNIAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALC YTIVTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQ ELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGYL ALVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQAK IQFTSGLDVVLSRKVIGLFTSILVNYLLILIQFAMTQKMGEQIEQQKIALQEWIGF |
| Source | in vitro E.coli expression system |
| Gene Names | Gr57a |
| Protein Names | Recommended name: Putative gustatory receptor 57a |
| Expression Region | 1-416 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr57a subfamily |
| Tissue Specificity | In larvae, is expressed in neurons of the terminal external chemosensory organ as well as in the dorsal pharyngeal sense organ. |
| Database Links |
KEGG: dme:Dmel_CG13441 STRING: 7227.FBpp0085554 UniGene: Dm.26980 |
Gr57a Antibodies for Drosophila melanogaster (Fruit fly)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA892696XA01DLU | GR57A Antibody | Drosophila melanogaster (Fruit fly) | ELISA, WB (ensure identification of antigen) |
Gr57a Proteins for Drosophila melanogaster (Fruit fly)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP892696DLU1 CSB-EP892696DLU1 CSB-BP892696DLU1 CSB-MP892696DLU1 |
Recombinant Drosophila melanogaster Putative gustatory receptor 57a(Gr57a),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Triangle waterfern Cyanovirin-N homolog
Express system: Yeast
Species: Ceratopteris richardii (Triangle waterfern)
Recombinant Human Mannan-binding lectin serine protease 1(MASP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Nuclear receptor ROR-gamma(Rorc)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Ras-related protein Rap-2b(RAP2B)
Express system: E.coli
Species: Homo sapiens (Human)
