Recombinant Drosophila melanogaster Putative gustatory receptor 59d(Gr59d)

Code CSB-CF349288DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P58985
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Drosophila melanogaster (Fruit fly)
Sequence MADLLKLCLRIAYAYGRLTGVINFKIDLKTGQALVTRGATLISVSTHLLIFALLLYQTMR KSVVNVMWKYANSLHEYVFLVIAGFRVVCVFLELVSRWSQRRTFVRLFNSFRRLYQRNPD IIQYCRRSIVSKFFCVTMTETLHIIVTLAMMRNRLSIALALRIWAVLSLTAIINVIITQY YVATACVRGRYALLNKDLQAIVTESQSLVPNGGGVFVTKCCYLADRLERIAKSQSDLQEL VENLSTAYEGEVVCLVITYYLNMLGTSYLLFSISKYGNFGNNLLVIITLCGIVYFVFYVV DCWINAFNVFYLLDAHDKMVKLLNKRTLFQPGLDHRLEMVFENFALNLVRNPLKLHMYGL FEFGRGTSFAVFNSLLTHSLLLIQYDVQNF
Source in vitro E.coli expression system
Gene Names Gr59d
Protein Names Recommended name: Putative gustatory receptor 59d
Expression Region 1-390
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Tissue Specificity Expressed in the adult labellar chemosensory neurons. In larvae, is expressed in neurons of the terminal external chemosensory organ as well as in the dorsal pharyngeal sense organ.
Database Links

KEGG: dme:Dmel_CG30330

STRING: 7227.FBpp0071886

UniGene: Dm.26350

Related Products

Gr59d Antibodies

Gr59d Antibodies for Drosophila melanogaster (Fruit fly)

Gr59d Proteins

Gr59d Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.