Recombinant Drosophila melanogaster Putative gustatory receptor 8a(Gr8a)

Code CSB-CF894308DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9W367
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MSGHLGRVLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFS GEEFLYRGDMFGCANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVS LRSEFQQFCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQF VLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRIYSHVYDML KCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYASQ SCMVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLT RMACSVGTYMIYSIQFIPKFSNTYM
Source in vitro E.coli expression system
Gene Names Gr8a
Protein Names Recommended name: Putative gustatory receptor 8a
Expression Region 1-385
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates. Required for sensing and avoiding L-canavanine, a plant-derived insecticide.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr2a subfamily
Database Links

KEGG: dme:Dmel_CG15371

STRING: 7227.FBpp0071246

UniGene: Dm.23791

Related Products

Gr8a Antibodies

Gr8a Antibodies for Drosophila melanogaster (Fruit fly)

Gr8a Proteins

Gr8a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.