Recombinant Drosophila melanogaster Putative gustatory receptor 92a(Gr92a)

Code CSB-CF815530DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8IN58
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MFEFLHQMSAPKLSTSILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRII TFTRFFWVYIASISIKTNRVLQVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRL FRQVSDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYL VSATNIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRLEKCI SLYREIYHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEFYLNSFIFWILLGKHVLD LFLVTVSVEGAVNQFLNIGMQFGNVGDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQM QYLQFLSALLSGLAFIAQYRMQVGNG
Source in vitro E.coli expression system
Gene Names Gr92a
Protein Names Recommended name: Putative gustatory receptor 92a
Expression Region 1-386
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr93a subfamily
Database Links

KEGG: dme:Dmel_CG31208

STRING: 7227.FBpp0083274

UniGene: Dm.26362

Related Products

Gr92a Antibodies

Gr92a Antibodies for Drosophila melanogaster (Fruit fly)

Gr92a Proteins

Gr92a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.