Recombinant Drosophila melanogaster Putative odorant receptor 19a(Or19a)

Code CSB-CF884838DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9I816
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MDISKVDSTRALVNHWRIFRIMGIHPPGKRTFWGRHYTAYSMVWNVTFHICIWVSFSVNL LQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGQMISSHWLLRLLDKRLGCDDERQIIM AGIERAEFIFRTIFRGLACTVVLGIIYISASSEPTLMYPTWIPWNWRDSTSAYLATAMLH TTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHD HQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTE TLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPIS MKTFTVMIKGAYTMLTLLNEIRKTSLE
Source in vitro E.coli expression system
Gene Names Or19a
Protein Names Recommended name: Putative odorant receptor 19a
Expression Region 1-387
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Involved in the preference for citrus fruits for oviposition, especially through the response to valencene, the primary ligand of Or19a. Larvae growing on citrus fruits suffer a reduced risk of parasitism since endoparasitoid wasps that parasitize larvae are strongly repelled by the smell of citrus, as well as by valencene.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Tissue Specificity Expressed in ai2A olfactory sensory neurons in the antenna.
Database Links

KEGG: dme:Dmel_CG18859

STRING: 7227.FBpp0070028

UniGene: Dm.27529

Related Products

Or19a Antibodies

Or19a Antibodies for Drosophila melanogaster (Fruit fly)

Or19a Proteins

Or19a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.