Recombinant Drosophila melanogaster Putative odorant receptor 1a(Or1a)

Code CSB-CF894316DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9W5G6
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MSKLIEVFLGNLWTQRFTFARMGLDLQPDKKGNVLRSPLLYCIMCLTTSFELCTVCAFMV QNRNQIVLCSEALMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQ NQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVY AMDCCLMVFVLSFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLS GIFVEHARLLKIVQHFNYSFMEIAFVEVVIICGLYCSVICQYIMPHTNQNFAFLGFFSLV VTTQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGAYF FELGRPLLVWIFRTAGSFTTLMNALYAKYETH
Source in vitro E.coli expression system
Gene Names Or1a
Protein Names Recommended name: Putative odorant receptor 1a
Expression Region 1-392
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Involved in the behavioral responses to butanal, heptanal, and 2-heptanone.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or1a subfamily
Tissue Specificity Expressed in olfactory sensory neurons in the maxillary palp.
Database Links

KEGG: dme:Dmel_CG17885

STRING: 7227.FBpp0070069

Related Products

Or1a Antibodies

Or1a Antibodies for Drosophila melanogaster (Fruit fly)

Or1a Proteins

Or1a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.